Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [48889] (3 PDB entries) |
Domain d1dqqa1: 1dqq A:1-107 [20420] Other proteins in same PDB: d1dqqa2, d1dqqb2, d1dqqc2, d1dqqd2 |
PDB Entry: 1dqq (more details), 1.8 Å
SCOP Domain Sequences for d1dqqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqqa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain} divltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgips rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik
Timeline for d1dqqa1: