Lineage for d2fdwb_ (2fdw B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1744326Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1744327Protein automated matches [190847] (45 species)
    not a true protein
  7. 1744362Species Human (Homo sapiens) [TaxId:9606] [196470] (29 PDB entries)
  8. 1744384Domain d2fdwb_: 2fdw B: [204199]
    automated match to d1dt6a_
    complexed with d3g, hem

Details for d2fdwb_

PDB Entry: 2fdw (more details), 2.05 Å

PDB Description: Crystal Structure Of Human Microsomal P450 2A6 with the inhibitor (5-(Pyridin-3-yl)furan-2-yl)methanamine bound
PDB Compounds: (B:) Cytochrome P450 2A6

SCOPe Domain Sequences for d2fdwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdwb_ a.104.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavreal
vdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriqe
eagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifqf
tststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfidsf
lirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvheei
drvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgtev
ypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelfl
ffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflprhh

SCOPe Domain Coordinates for d2fdwb_:

Click to download the PDB-style file with coordinates for d2fdwb_.
(The format of our PDB-style files is described here.)

Timeline for d2fdwb_: