![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196470] (52 PDB entries) |
![]() | Domain d2fdwb1: 2fdw B:32-494 [204199] Other proteins in same PDB: d2fdwb2 automated match to d1dt6a_ complexed with d3g, hem |
PDB Entry: 2fdw (more details), 2.05 Å
SCOPe Domain Sequences for d2fdwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fdwb1 a.104.1.0 (B:32-494) automated matches {Human (Homo sapiens) [TaxId: 9606]} klppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavreal vdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriqe eagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgifqf tststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfidsf lirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvheei drvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgtev ypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelfl ffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr
Timeline for d2fdwb1: