Lineage for d2fdwa_ (2fdw A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (54 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005594Domain d2fdwa_: 2fdw A: [204198]
    Other proteins in same PDB: d2fdwb2
    automated match to d1dt6a_
    complexed with d3g, hem

Details for d2fdwa_

PDB Entry: 2fdw (more details), 2.05 Å

PDB Description: Crystal Structure Of Human Microsomal P450 2A6 with the inhibitor (5-(Pyridin-3-yl)furan-2-yl)methanamine bound
PDB Compounds: (A:) Cytochrome P450 2A6

SCOPe Domain Sequences for d2fdwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdwa_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavre
alvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeri
qeeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgif
qftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfid
sflirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvhe
eidrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgt
evypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmel
flffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr

SCOPe Domain Coordinates for d2fdwa_:

Click to download the PDB-style file with coordinates for d2fdwa_.
(The format of our PDB-style files is described here.)

Timeline for d2fdwa_: