SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2fdwa_ (2fdw A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (57 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005594Domain d2fdwa_: 2fdw A: [204198]
    Other proteins in same PDB: d2fdwb2
    automated match to d1dt6a_
    complexed with d3g, hem

Details for d2fdwa_

PDB Entry: 2fdw (more details), 2.05 Å

PDB Description: Crystal Structure Of Human Microsomal P450 2A6 with the inhibitor (5-(Pyridin-3-yl)furan-2-yl)methanamine bound
PDB Compounds: (A:) Cytochrome P450 2A6

SCOPe Domain Sequences for d2fdwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdwa_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavre
alvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeri
qeeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgif
qftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfid
sflirmqeeeknpntefylknlvmttlnlfiggtetvsttlrygflllmkhpeveakvhe
eidrvigknrqpkfedrakmpymeaviheiqrfgdvipmslarrvkkdtkfrdfflpkgt
evypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmel
flffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr

SCOPe Domain Coordinates for d2fdwa_:

Click to download the PDB-style file with coordinates for d2fdwa_.
(The format of our PDB-style files is described here.)

Timeline for d2fdwa_: