SCOP 1.63: Domain d1cl7h1: 1cl7 H:1-113

Lineage for d1cl7h1 (1cl7 H:1-113)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 1696, (mouse), kappa L chain [48888] (1 PDB entry)
   against HIV-1 protease

8. Domain d1cl7h1: 1cl7 H:1-113 [20419]
   Other proteins in same PDB: d1cl7.1, d1cl7l2

Details for d1cl7h1

PDB Entry: 1cl7, 3 Å

PDB Description: anti hiv1 protease fab

SCOP Domain Sequences for d1cl7h1:

Sequence; same for both SEQRES and ATOM records:

>d1cl7h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab 1696, (mouse), kappa L chain}
qiqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss

Timeline for d1cl7h1:

• d1cl7h1 first appeared (with stable ids) in SCOP 1.55
  
• d1cl7h1 appears in SCOP 1.61
  
• d1cl7h1 appears in SCOP 1.65
  
• d1cl7h1 appears in the current release, SCOPe 2.08