Lineage for d1cl7h1 (1cl7 H:1-113)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219385Species Fab 1696, (mouse), kappa L chain [48888] (1 PDB entry)
    against HIV-1 protease
  8. 219386Domain d1cl7h1: 1cl7 H:1-113 [20419]
    Other proteins in same PDB: d1cl7.1, d1cl7l2

Details for d1cl7h1

PDB Entry: 1cl7 (more details), 3 Å

PDB Description: anti hiv1 protease fab

SCOP Domain Sequences for d1cl7h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl7h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab 1696, (mouse), kappa L chain}
qiqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss

SCOP Domain Coordinates for d1cl7h1:

Click to download the PDB-style file with coordinates for d1cl7h1.
(The format of our PDB-style files is described here.)

Timeline for d1cl7h1: