SCOPe 2.03: Domain d2fb9a2: 2fb9 A:118-322

Lineage for d2fb9a2 (2fb9 A:118-322)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (18 species)
   not a true protein

7. Species Thermus caldophilus [TaxId:272] [225125] (1 PDB entry)

8. Domain d2fb9a2: 2fb9 A:118-322 [204189]
   Other proteins in same PDB: d2fb9a1
   automated match to d1e4ea2

Details for d2fb9a2

PDB Entry: 2fb9, 1.9 Å

PDB Description: Crystal structure of the Apo form of D-alanine: D-alanine ligase (Ddl) from Thermus caldophilus: a basis for the substrate-induced conformational changes

PDB Compounds: (A:) D-alanine:D-alanine ligase

SCOPe Domain Sequences for d2fb9a2:

Sequence; same for both SEQRES and ATOM records:

>d2fb9a2 d.142.1.0 (A:118-322) automated matches {Thermus caldophilus [TaxId: 272]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Timeline for d2fb9a2:

• d2fb9a2 is new in SCOPe 2.03-stable
  
• d2fb9a2 appears in SCOPe 2.04
  
• d2fb9a2 appears in the current release, SCOPe 2.08