Lineage for d2fahc2 (2fah C:279-641)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1623982Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 1623983Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 1624093Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 1624094Protein automated matches [196142] (5 species)
    not a true protein
  7. 1624100Species Chicken (Gallus gallus) [TaxId:9031] [225084] (3 PDB entries)
  8. 1624107Domain d2fahc2: 2fah C:279-641 [204185]
    Other proteins in same PDB: d2faha1, d2fahb1, d2fahc1, d2fahd1
    automated match to d1khba1
    complexed with 20s, gdp, mla, mn

Details for d2fahc2

PDB Entry: 2fah (more details), 2.09 Å

PDB Description: the structure of mitochondrial pepck, complex with mn and gdp
PDB Compounds: (C:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2fahc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fahc2 c.91.1.0 (C:279-641) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
wlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiawmkfdd
egrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgldeptep
gvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifggrrpr
gvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagrylehwls
tglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptpigwvp
kegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaelegleerv
rkm

SCOPe Domain Coordinates for d2fahc2:

Click to download the PDB-style file with coordinates for d2fahc2.
(The format of our PDB-style files is described here.)

Timeline for d2fahc2: