Lineage for d2fahb1 (2fah B:34-278)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168058Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2168059Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2168155Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 2168156Protein automated matches [226847] (5 species)
    not a true protein
  7. 2168162Species Chicken (Gallus gallus) [TaxId:9031] [225083] (4 PDB entries)
  8. 2168170Domain d2fahb1: 2fah B:34-278 [204182]
    Other proteins in same PDB: d2faha2, d2fahb2, d2fahc2, d2fahd2
    automated match to d1khba2
    complexed with 20s, gdp, mla, mn

Details for d2fahb1

PDB Entry: 2fah (more details), 2.09 Å

PDB Description: the structure of mitochondrial pepck, complex with mn and gdp
PDB Compounds: (B:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2fahb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fahb1 c.109.1.0 (B:34-278) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
aqqqg

SCOPe Domain Coordinates for d2fahb1:

Click to download the PDB-style file with coordinates for d2fahb1.
(The format of our PDB-style files is described here.)

Timeline for d2fahb1: