SCOPe 2.05: Domain d2faha1: 2fah A:34-278

Lineage for d2faha1 (2fah A:34-278)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.0: automated matches [227144] (1 protein)
   not a true family

6. Protein automated matches [226847] (5 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225083] (3 PDB entries)

8. Domain d2faha1: 2fah A:34-278 [204180]
   Other proteins in same PDB: d2faha2, d2fahb2, d2fahc2, d2fahd2
   automated match to d1khba2
   complexed with 20s, gdp, mla, mn

Details for d2faha1

PDB Entry: 2fah, 2.09 Å

PDB Description: the structure of mitochondrial pepck, complex with mn and gdp

PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2faha1:

Sequence; same for both SEQRES and ATOM records:

>d2faha1 c.109.1.0 (A:34-278) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
aqqqg

Timeline for d2faha1:

• d2faha1 first appeared in SCOPe 2.03
  
• d2faha1 appears in SCOPe 2.04
  
• d2faha1 appears in SCOPe 2.06
  
• d2faha1 appears in the current release, SCOPe 2.08