SCOP 1.73: Domain d1cl7l1: 1cl7 L:1-107

Lineage for d1cl7l1 (1cl7 L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d1cl7l1: 1cl7 L:1-107 [20418]
   Other proteins in same PDB: d1cl7.1, d1cl7h1, d1cl7l2
   part of Fab 1696 against HIV-1 protease

Details for d1cl7l1

PDB Entry: 1cl7, 3 Å

PDB Description: anti hiv1 protease fab

PDB Compounds: (L:) PROTEIN (IGG1 ANTIBODY 1696 (light chain))

SCOP Domain Sequences for d1cl7l1:

Sequence; same for both SEQRES and ATOM records:

>d1cl7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvlmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleik

Timeline for d1cl7l1:

• d1cl7l1 first appeared (with stable ids) in SCOP 1.55
  
• d1cl7l1 appears in SCOP 1.71
  
• d1cl7l1 appears in SCOP 1.75
  
• d1cl7l1 appears in the current release, SCOPe 2.08