![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.0: automated matches [227144] (1 protein) not a true family |
![]() | Protein automated matches [226847] (5 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [225083] (4 PDB entries) |
![]() | Domain d2fafb1: 2faf B:34-278 [204178] Other proteins in same PDB: d2fafa2, d2fafb2 automated match to d1khba2 complexed with 1pe, epe, mn |
PDB Entry: 2faf (more details), 1.7 Å
SCOPe Domain Sequences for d2fafb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fafb1 c.109.1.0 (B:34-278) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm aqqqg
Timeline for d2fafb1: