Lineage for d2fafa1 (2faf A:34-278)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1394734Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 1394735Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 1394808Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 1394809Protein automated matches [226847] (3 species)
    not a true protein
  7. 1394813Species Chicken (Gallus gallus) [TaxId:9031] [225083] (3 PDB entries)
  8. 1394814Domain d2fafa1: 2faf A:34-278 [204176]
    Other proteins in same PDB: d2fafa2, d2fafb2
    automated match to d1khba2
    complexed with 1pe, 20s, epe, mn

Details for d2fafa1

PDB Entry: 2faf (more details), 1.7 Å

PDB Description: the structure of chicken mitochondrial pepck.
PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2fafa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fafa1 c.109.1.0 (A:34-278) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
aqqqg

SCOPe Domain Coordinates for d2fafa1:

Click to download the PDB-style file with coordinates for d2fafa1.
(The format of our PDB-style files is described here.)

Timeline for d2fafa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fafa2