Lineage for d2f42a2 (2f42 A:205-282)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264067Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2264068Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2264130Family g.44.1.2: U-box [90222] (5 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 2264147Protein automated matches [190212] (2 species)
    not a true protein
  7. 2264155Species Zebrafish (Danio rerio) [TaxId:7955] [225070] (2 PDB entries)
  8. 2264156Domain d2f42a2: 2f42 A:205-282 [204172]
    Other proteins in same PDB: d2f42a1
    automated match to d2c2la2
    complexed with cl

Details for d2f42a2

PDB Entry: 2f42 (more details), 2.5 Å

PDB Description: dimerization and U-box domains of Zebrafish C-terminal of HSP70 interacting protein
PDB Compounds: (A:) STIP1 homology and U-Box containing protein 1

SCOPe Domain Sequences for d2f42a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f42a2 g.44.1.2 (A:205-282) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
kreipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfdpvtrspltqdqlipn
lamkevidafiqengwve

SCOPe Domain Coordinates for d2f42a2:

Click to download the PDB-style file with coordinates for d2f42a2.
(The format of our PDB-style files is described here.)

Timeline for d2f42a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f42a1