Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) |
Family a.118.8.0: automated matches [191581] (1 protein) not a true family |
Protein automated matches [191037] (12 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [225069] (1 PDB entry) |
Domain d2f42a1: 2f42 A:127-204 [204171] Other proteins in same PDB: d2f42a2 automated match to d2c2la1 complexed with cl |
PDB Entry: 2f42 (more details), 2.5 Å
SCOPe Domain Sequences for d2f42a1:
Sequence, based on SEQRES records: (download)
>d2f42a1 a.118.8.0 (A:127-204) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} akkkrwnsieekrisqenelhaylsklilaekerelddrvkqsddsqnggdiskmkskhd kylmdmdelfsqvdekrk
>d2f42a1 a.118.8.0 (A:127-204) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} akkkrwnsieekrisqenelhaylsklilaekerelddskhdkylmdmdelfsqvdekrk
Timeline for d2f42a1: