Lineage for d2f42a1 (2f42 A:127-204)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746069Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1746290Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 1746291Protein automated matches [191037] (10 species)
    not a true protein
  7. 1746324Species Zebrafish (Danio rerio) [TaxId:7955] [225069] (1 PDB entry)
  8. 1746325Domain d2f42a1: 2f42 A:127-204 [204171]
    Other proteins in same PDB: d2f42a2
    automated match to d2c2la1
    complexed with cl

Details for d2f42a1

PDB Entry: 2f42 (more details), 2.5 Å

PDB Description: dimerization and U-box domains of Zebrafish C-terminal of HSP70 interacting protein
PDB Compounds: (A:) STIP1 homology and U-Box containing protein 1

SCOPe Domain Sequences for d2f42a1:

Sequence, based on SEQRES records: (download)

>d2f42a1 a.118.8.0 (A:127-204) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
akkkrwnsieekrisqenelhaylsklilaekerelddrvkqsddsqnggdiskmkskhd
kylmdmdelfsqvdekrk

Sequence, based on observed residues (ATOM records): (download)

>d2f42a1 a.118.8.0 (A:127-204) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
akkkrwnsieekrisqenelhaylsklilaekerelddskhdkylmdmdelfsqvdekrk

SCOPe Domain Coordinates for d2f42a1:

Click to download the PDB-style file with coordinates for d2f42a1.
(The format of our PDB-style files is described here.)

Timeline for d2f42a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f42a2