Lineage for d1f3rb2 (1f3r B:139-257)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 364043Species Rat (Rattus norvegicus) [TaxId:10116] [88532] (7 PDB entries)
  8. 364056Domain d1f3rb2: 1f3r B:139-257 [20417]
    Other proteins in same PDB: d1f3rb1
    part of scFv MAB198 against the main immunogenic region of the human muscle acetylcholine receptor; order: VH-linker-VL
    mutant

Details for d1f3rb2

PDB Entry: 1f3r (more details)

PDB Description: complex between fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor

SCOP Domain Sequences for d1f3rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus)}
dikltqspsllsasvgdrvtlsckgsqninnylawyqqklgeapklliyntnslqtgips
rfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtklelkaaeqkliseedln

SCOP Domain Coordinates for d1f3rb2:

Click to download the PDB-style file with coordinates for d1f3rb2.
(The format of our PDB-style files is described here.)

Timeline for d1f3rb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f3rb1