SCOPe 2.08: Domain d2eytc2: 2eyt C:118-205

Lineage for d2eytc2 (2eyt C:118-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d2eytc2: 2eyt C:118-205 [204168]
   Other proteins in same PDB: d2eyta1, d2eytb1, d2eytc1, d2eytd1
   automated match to d1qrnd2

Details for d2eytc2

PDB Entry: 2eyt, 2.6 Å

PDB Description: A structural basis for selection and cross-species reactivity of the semi-invariant NKT cell receptor in CD1d/glycolipid recognition

PDB Compounds: (C:) nkt15

SCOPe Domain Sequences for d2eytc2:

Sequence; same for both SEQRES and ATOM records:

>d2eytc2 b.1.1.2 (C:118-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Timeline for d2eytc2:

• d2eytc2 first appeared in SCOPe 2.03
  
• d2eytc2 appears in SCOPe 2.07