SCOPe 2.06: Domain d2eysb2: 2eys B:120-247

Lineage for d2eysb2 (2eys B:120-247)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d2eysb2: 2eys B:120-247 [204162]
   Other proteins in same PDB: d2eysa1, d2eysb1
   automated match to d1qsee2
   complexed with acy

Details for d2eysb2

PDB Entry: 2eys, 2.21 Å

PDB Description: A structural basis for selection and cross-species reactivity of the semi-invariant NKT cell receptor in CD1d/glycolipid recognition

PDB Compounds: (B:) nkt15

SCOPe Domain Sequences for d2eysb2:

Sequence; same for both SEQRES and ATOM records:

>d2eysb2 b.1.1.2 (B:120-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Timeline for d2eysb2:

• d2eysb2 first appeared in SCOPe 2.03
  
• d2eysb2 appears in SCOPe 2.05
  
• d2eysb2 appears in SCOPe 2.07
  
• d2eysb2 appears in the current release, SCOPe 2.08