Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species |
Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (7 PDB entries) |
Domain d1f3rb1: 1f3r B:1-123 [20416] Other proteins in same PDB: d1f3rb2 part of scFv MAB198 against the main immunogenic region of the human muscle acetylcholine receptor; order: VH-linker-VL mutant |
PDB Entry: 1f3r (more details)
SCOP Domain Sequences for d1f3rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3rb1 b.1.1.1 (B:1-123) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)} qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpgtmvt vss
Timeline for d1f3rb1: