SCOPe 2.07: Domain d2es0a1: 2es0 A:325-452

Lineage for d2es0a1 (2es0 A:325-452)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (34 PDB entries)

8. Domain d2es0a1: 2es0 A:325-452 [204142]
   Other proteins in same PDB: d2es0a2
   automated match to d1fqkb_

Details for d2es0a1

PDB Entry: 2es0, 2.1 Å

PDB Description: structure of the regulator of g-protein signaling domain of rgs6

PDB Compounds: (A:) regulator of G-protein signalling 6

SCOPe Domain Sequences for d2es0a1:

Sequence; same for both SEQRES and ATOM records:

>d2es0a1 a.91.1.0 (A:325-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psqqrvkrwgfsfdeilkdqvgrdqflrflesefssenlrfwlavqdlkkqplqdvakrv
eeiwqeflapgapsainldshsyeitsqnvkdggrytfedaqehiyklmksdsyarflrs
nayqdlll

Timeline for d2es0a1:

• d2es0a1 first appeared in SCOPe 2.03, called d2es0a_
  
• d2es0a1 appears in SCOPe 2.06