SCOPe 2.05: Domain d2erbb_: 2erb B:

Lineage for d2erbb_ (2erb B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.0: automated matches [191595] (1 protein)
   not a true family

6. Protein automated matches [191085] (7 species)
   not a true protein

7. Species Anopheles gambiae [TaxId:180454] [193180] (3 PDB entries)

8. Domain d2erbb_: 2erb B: [204141]
   automated match to d4fqtb_
   complexed with mg, peu

Details for d2erbb_

PDB Entry: 2erb, 1.5 Å

PDB Description: AgamOBP1, and odorant binding protein from Anopheles gambiae complexed with PEG

PDB Compounds: (B:) odorant binding protein

SCOPe Domain Sequences for d2erbb_:

Sequence; same for both SEQRES and ATOM records:

>d2erbb_ a.39.2.0 (B:) automated matches {Anopheles gambiae [TaxId: 180454]}
tprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfhea
kvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpkhy
flv

Timeline for d2erbb_:

• d2erbb_ first appeared in SCOPe 2.03
  
• d2erbb_ appears in SCOPe 2.04
  
• d2erbb_ appears in SCOPe 2.06
  
• d2erbb_ appears in the current release, SCOPe 2.08