![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
![]() | Family a.39.2.0: automated matches [191595] (1 protein) not a true family |
![]() | Protein automated matches [191085] (10 species) not a true protein |
![]() | Species Anopheles gambiae [TaxId:180454] [193180] (4 PDB entries) |
![]() | Domain d2erba_: 2erb A: [204140] automated match to d4fqtb_ complexed with mg, peu |
PDB Entry: 2erb (more details), 1.5 Å
SCOPe Domain Sequences for d2erba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2erba_ a.39.2.0 (A:) automated matches {Anopheles gambiae [TaxId: 180454]} tprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfhea kvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpkhy flv
Timeline for d2erba_: