Lineage for d2eo4a_ (2eo4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929994Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2929995Protein automated matches [191122] (10 species)
    not a true protein
  7. 2930043Species Sulfolobus tokodaii [TaxId:111955] [225340] (1 PDB entry)
  8. 2930044Domain d2eo4a_: 2eo4 A: [204131]
    automated match to d3imia_
    complexed with po4, zn

Details for d2eo4a_

PDB Entry: 2eo4 (more details), 1.8 Å

PDB Description: Crystal structure of hypothetical histidine triad nucleotide-binding protein ST2152 from Sulfolobus tokodaii strain7
PDB Compounds: (A:) 150aa long hypothetical histidine triad nucleotide-binding protein

SCOPe Domain Sequences for d2eo4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eo4a_ d.13.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
ctfcsiinrelegyfvyedekfaaildkypvslghtlvipkkhfenyleadedtlaelak
vvklvslgikdavkadglrlltnigrsagqvifhlhvhiiptwegdypdifksfkprkeq
ekeyyellqkiiresienlkrkigdykwg

SCOPe Domain Coordinates for d2eo4a_:

Click to download the PDB-style file with coordinates for d2eo4a_.
(The format of our PDB-style files is described here.)

Timeline for d2eo4a_: