![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.0: automated matches [191614] (1 protein) not a true family |
![]() | Protein automated matches [191122] (10 species) not a true protein |
![]() | Species Sulfolobus tokodaii [TaxId:111955] [225340] (1 PDB entry) |
![]() | Domain d2eo4a_: 2eo4 A: [204131] automated match to d3imia_ complexed with po4, zn |
PDB Entry: 2eo4 (more details), 1.8 Å
SCOPe Domain Sequences for d2eo4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eo4a_ d.13.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]} ctfcsiinrelegyfvyedekfaaildkypvslghtlvipkkhfenyleadedtlaelak vvklvslgikdavkadglrlltnigrsagqvifhlhvhiiptwegdypdifksfkprkeq ekeyyellqkiiresienlkrkigdykwg
Timeline for d2eo4a_: