Lineage for d2ei9a_ (2ei9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988254Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2988255Protein automated matches [190734] (14 species)
    not a true protein
  7. 2988305Species Silkworm (Bombyx mori) [TaxId:7091] [225293] (1 PDB entry)
  8. 2988306Domain d2ei9a_: 2ei9 A: [204126]
    automated match to d1wdua_
    complexed with acy

Details for d2ei9a_

PDB Entry: 2ei9 (more details), 2 Å

PDB Description: Crystal structure of R1Bm endonuclease domain
PDB Compounds: (A:) Non-LTR retrotransposon R1Bmks ORF2 protein

SCOPe Domain Sequences for d2ei9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ei9a_ d.151.1.0 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
prlrigqinlggaedatrelpsiardlgldivlvqeqysmvgflaqcgahpkagvyirnr
vlpcavlhhlssthitvvhiggwdlymvsayfqysdpidpylhrlgnildrlrgarvvic
adtnahsplwhslprhyvgrgqevadrrakmedfigarrlvvhnadghlptfstangesy
vdvtlstrgvrvsewrvtnesssdhrlivfgvgg

SCOPe Domain Coordinates for d2ei9a_:

Click to download the PDB-style file with coordinates for d2ei9a_.
(The format of our PDB-style files is described here.)

Timeline for d2ei9a_: