![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
![]() | Protein automated matches [190734] (14 species) not a true protein |
![]() | Species Silkworm (Bombyx mori) [TaxId:7091] [225293] (1 PDB entry) |
![]() | Domain d2ei9a_: 2ei9 A: [204126] automated match to d1wdua_ complexed with acy |
PDB Entry: 2ei9 (more details), 2 Å
SCOPe Domain Sequences for d2ei9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ei9a_ d.151.1.0 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} prlrigqinlggaedatrelpsiardlgldivlvqeqysmvgflaqcgahpkagvyirnr vlpcavlhhlssthitvvhiggwdlymvsayfqysdpidpylhrlgnildrlrgarvvic adtnahsplwhslprhyvgrgqevadrrakmedfigarrlvvhnadghlptfstangesy vdvtlstrgvrvsewrvtnesssdhrlivfgvgg
Timeline for d2ei9a_: