Lineage for d2ehba_ (2ehb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711817Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226776] (4 PDB entries)
  8. 2711818Domain d2ehba_: 2ehb A: [204125]
    automated match to d2zfda1
    complexed with ca

Details for d2ehba_

PDB Entry: 2ehb (more details), 2.1 Å

PDB Description: The structure of the C-terminal domain of the protein kinase AtSOS2 bound to the calcium sensor AtSOS3
PDB Compounds: (A:) Calcineurin B-like protein 4

SCOPe Domain Sequences for d2ehba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehba_ a.39.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dpellasvtpftveevealyelfkklsssiiddglihkeefqlalfrnrnrrnlfadrif
dvfdvkrngviefgefvrslgvfhpsapvhekvkfafklydlrqtgfiereelkemvval
lheselvlsedmievmvdkafvqadrkndgkididewkdfvslnpsliknmtlpylkdin
rt

SCOPe Domain Coordinates for d2ehba_:

Click to download the PDB-style file with coordinates for d2ehba_.
(The format of our PDB-style files is described here.)

Timeline for d2ehba_: