SCOP 1.73: Domain d1c5dl1: 1c5d L:1-106

Lineage for d1c5dl1 (1c5d L:1-106)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88532] (8 PDB entries)

8. Domain d1c5dl1: 1c5d L:1-106 [20412]
   Other proteins in same PDB: d1c5da2, d1c5db1, d1c5db2, d1c5dh1, d1c5dh2, d1c5dl2

Details for d1c5dl1

PDB Entry: 1c5d, 2.4 Å

PDB Description: the crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

PDB Compounds: (L:) monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor

SCOP Domain Sequences for d1c5dl1:

Sequence; same for both SEQRES and ATOM records:

>d1c5dl1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqsppslsaslgdkvtitcqasqdinkyiawyqqkpgkaprqlirytsilvlgtps
rfsgsgsgrdfsfsisnvasediasyyclqygnlytfgagtkleik

Timeline for d1c5dl1:

• d1c5dl1 first appeared (with stable ids) in SCOP 1.55
  
• d1c5dl1 appears in SCOP 1.71
  
• d1c5dl1 appears in SCOP 1.75
  
• d1c5dl1 appears in the current release, SCOPe 2.08