| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (14 PDB entries) |
| Domain d1c5dl1: 1c5d L:1-106 [20412] Other proteins in same PDB: d1c5da2, d1c5db1, d1c5db2, d1c5dh1, d1c5dh2, d1c5dl2 part of antibody against the main immunogenic region of the human muscle acetylcholine receptor |
PDB Entry: 1c5d (more details), 2.4 Å
SCOPe Domain Sequences for d1c5dl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5dl1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqsppslsaslgdkvtitcqasqdinkyiawyqqkpgkaprqlirytsilvlgtps
rfsgsgsgrdfsfsisnvasediasyyclqygnlytfgagtkleik
Timeline for d1c5dl1: