Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins) |
Protein Shikimate 5-dehydrogenase AroE [89584] (6 species) |
Species Geobacillus kaustophilus [TaxId:1462] [225425] (1 PDB entry) |
Domain d2eggb1: 2egg B:22-122 [204118] Other proteins in same PDB: d2egga2, d2egga3, d2eggb2, d2eggb3 automated match to d1nvta2 complexed with cl |
PDB Entry: 2egg (more details), 2.25 Å
SCOPe Domain Sequences for d2eggb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eggb1 c.58.1.5 (B:22-122) Shikimate 5-dehydrogenase AroE {Geobacillus kaustophilus [TaxId: 1462]} mekvygligfpvehslsplmhndafarlgiparyhlfsvepgqvgaaiagvralgiagvn vtiphklavipfldevdeharrigavntiinndgrlvgynt
Timeline for d2eggb1: