Lineage for d2eggb1 (2egg B:22-122)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890580Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 2890589Protein Shikimate 5-dehydrogenase AroE [89584] (6 species)
  7. 2890610Species Geobacillus kaustophilus [TaxId:1462] [225425] (1 PDB entry)
  8. 2890612Domain d2eggb1: 2egg B:22-122 [204118]
    Other proteins in same PDB: d2egga2, d2egga3, d2eggb2, d2eggb3
    automated match to d1nvta2
    complexed with cl

Details for d2eggb1

PDB Entry: 2egg (more details), 2.25 Å

PDB Description: crystal structure of shikimate 5-dehydrogenase (aroe) from geobacillus kaustophilus
PDB Compounds: (B:) Shikimate 5-dehydrogenase

SCOPe Domain Sequences for d2eggb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eggb1 c.58.1.5 (B:22-122) Shikimate 5-dehydrogenase AroE {Geobacillus kaustophilus [TaxId: 1462]}
mekvygligfpvehslsplmhndafarlgiparyhlfsvepgqvgaaiagvralgiagvn
vtiphklavipfldevdeharrigavntiinndgrlvgynt

SCOPe Domain Coordinates for d2eggb1:

Click to download the PDB-style file with coordinates for d2eggb1.
(The format of our PDB-style files is described here.)

Timeline for d2eggb1: