![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Shikimate 5-dehydrogenase AroE [89538] (6 species) |
![]() | Species Geobacillus kaustophilus [TaxId:1462] [225426] (1 PDB entry) |
![]() | Domain d2egga2: 2egg A:123-297 [204117] Other proteins in same PDB: d2egga1, d2eggb1 automated match to d1nvta1 complexed with cl |
PDB Entry: 2egg (more details), 2.25 Å
SCOPe Domain Sequences for d2egga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2egga2 c.2.1.7 (A:123-297) Shikimate 5-dehydrogenase AroE {Geobacillus kaustophilus [TaxId: 1462]} dglgyvqaleeemnitldgkrilvigagggargiyfsllstaaeridmanrtvekaerlv regderrsayfslaeaetrlaeydiiinttsvgmhprvevqplslerlrpgvivsdiiyn pletkwlkeakargarvqngvgmlvyqgalafekwtgqwpdvnrmkqlviealrr
Timeline for d2egga2: