SCOPe 2.03: Domain d2egga1: 2egg A:20-122

Lineage for d2egga1 (2egg A:20-122)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)

6. Protein Shikimate 5-dehydrogenase AroE [89584] (6 species)

7. Species Geobacillus kaustophilus [TaxId:1462] [225425] (1 PDB entry)

8. Domain d2egga1: 2egg A:20-122 [204116]
   Other proteins in same PDB: d2egga2, d2eggb2
   automated match to d1nvta2
   complexed with cl

Details for d2egga1

PDB Entry: 2egg, 2.25 Å

PDB Description: crystal structure of shikimate 5-dehydrogenase (aroe) from geobacillus kaustophilus

PDB Compounds: (A:) Shikimate 5-dehydrogenase

SCOPe Domain Sequences for d2egga1:

Sequence; same for both SEQRES and ATOM records:

>d2egga1 c.58.1.5 (A:20-122) Shikimate 5-dehydrogenase AroE {Geobacillus kaustophilus [TaxId: 1462]}
ghmekvygligfpvehslsplmhndafarlgiparyhlfsvepgqvgaaiagvralgiag
vnvtiphklavipfldevdeharrigavntiinndgrlvgynt

Timeline for d2egga1:

• d2egga1 is new in SCOPe 2.03-stable
  
• d2egga1 appears in SCOPe 2.04
  
• d2egga1 appears in the current release, SCOPe 2.08