SCOPe 2.05: Domain d2ed4b_: 2ed4 B:

Lineage for d2ed4b_ (2ed4 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (19 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225396] (3 PDB entries)

8. Domain d2ed4b_: 2ed4 B: [204113]
   automated match to d3cb0a_
   complexed with fad, nad

Details for d2ed4b_

PDB Entry: 2ed4, 1.85 Å

PDB Description: crystal structure of flavin reductase hpac complexed with fad and nad

PDB Compounds: (B:) flavin reductase (HpaC) of 4-hydroxyphenylacetate 3-monooxygenae

SCOPe Domain Sequences for d2ed4b_:

Sequence; same for both SEQRES and ATOM records:

>d2ed4b_ b.45.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkeafkealarfasgvtvvaarlgeeergmtatafmslslepplvalavserakllpvle
gagaftvsllregqeavsehfagrpkegialeegrvkgalavlrcrlhalypggdhrivv
glveevelgeggpplvyfqrgyrrlvwps

Timeline for d2ed4b_:

• d2ed4b_ first appeared in SCOPe 2.03
  
• d2ed4b_ appears in SCOPe 2.04
  
• d2ed4b_ appears in SCOPe 2.06
  
• d2ed4b_ appears in the current release, SCOPe 2.08