Lineage for d1ct8d1 (1ct8 D:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740451Species Mouse (Mus musculus), cluster 3.3 [TaxId:10090] [88553] (1 PDB entry)
  8. 2740453Domain d1ct8d1: 1ct8 D:1-113 [20411]
    Other proteins in same PDB: d1ct8a1, d1ct8a2, d1ct8b2, d1ct8c1, d1ct8c2, d1ct8d2
    part of catalytic Fab 7C8
    complexed with so4, taa

Details for d1ct8d1

PDB Entry: 1ct8 (more details), 2.2 Å

PDB Description: catalytic antibody 7c8 complex
PDB Compounds: (D:) 7c8 fab fragment; long chain

SCOPe Domain Sequences for d1ct8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct8d1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]}
qvkllesgavlvkpgasvklscktsgftfsssyinwlkqkpgqslewiawiyagsggtvy
nqhftdkarltvdtssstaymqfsslttedsaiyycaryrydegfaywgqgtlvtvsa

SCOPe Domain Coordinates for d1ct8d1:

Click to download the PDB-style file with coordinates for d1ct8d1.
(The format of our PDB-style files is described here.)

Timeline for d1ct8d1: