SCOPe 2.06: Domain d2ecrb_: 2ecr B:

Lineage for d2ecrb_ (2ecr B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (20 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225396] (3 PDB entries)

8. Domain d2ecrb_: 2ecr B: [204109]
   automated match to d3cb0a_

Details for d2ecrb_

PDB Entry: 2ecr, 1.6 Å

PDB Description: crystal structure of the ligand-free form of the flavin reductase component (hpac) of 4-hydroxyphenylacetate 3-monooxygenase

PDB Compounds: (B:) flavin reductase component (HpaC) of 4-hydroxyphenylacetate 3-monooxygenase

SCOPe Domain Sequences for d2ecrb_:

Sequence; same for both SEQRES and ATOM records:

>d2ecrb_ b.45.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkeafkealarfasgvtvvaarlgeeergmtatafmslslepplvalavserakllpvle
gagaftvsllregqeavsehfagrpkegialeegrvkgalavlrcrlhalypggdhrivv
glveevelgeggpplvyfqrgyrrlvwps

Timeline for d2ecrb_:

• d2ecrb_ first appeared in SCOPe 2.03
  
• d2ecrb_ appears in SCOPe 2.05
  
• d2ecrb_ appears in SCOPe 2.07
  
• d2ecrb_ appears in the current release, SCOPe 2.08