Class b: All beta proteins [48724] (177 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (20 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225396] (3 PDB entries) |
Domain d2ecrb_: 2ecr B: [204109] automated match to d3cb0a_ |
PDB Entry: 2ecr (more details), 1.6 Å
SCOPe Domain Sequences for d2ecrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ecrb_ b.45.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mkeafkealarfasgvtvvaarlgeeergmtatafmslslepplvalavserakllpvle gagaftvsllregqeavsehfagrpkegialeegrvkgalavlrcrlhalypggdhrivv glveevelgeggpplvyfqrgyrrlvwps
Timeline for d2ecrb_: