SCOPe 2.03: Domain d2ecra_: 2ecr A:

Lineage for d2ecra_ (2ecr A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (14 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [225396] (3 PDB entries)

8. Domain d2ecra_: 2ecr A: [204108]
   automated match to d3cb0a_

Details for d2ecra_

PDB Entry: 2ecr, 1.6 Å

PDB Description: crystal structure of the ligand-free form of the flavin reductase component (hpac) of 4-hydroxyphenylacetate 3-monooxygenase

PDB Compounds: (A:) flavin reductase component (HpaC) of 4-hydroxyphenylacetate 3-monooxygenase

SCOPe Domain Sequences for d2ecra_:

Sequence; same for both SEQRES and ATOM records:

>d2ecra_ b.45.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
mkeafkealarfasgvtvvaarlgeeergmtatafmslslepplvalavserakllpvle
gagaftvsllregqeavsehfagrpkegialeegrvkgalavlrcrlhalypggdhrivv
glveevelgeggpplvyfqrgyrrlvwps

Timeline for d2ecra_:

• d2ecra_ is new in SCOPe 2.03-stable
  
• d2ecra_ appears in SCOPe 2.04
  
• d2ecra_ appears in the current release, SCOPe 2.08