![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [225241] (1 PDB entry) |
![]() | Domain d2ebah2: 2eba H:234-385 [204105] Other proteins in same PDB: d2ebaa1, d2ebac1, d2ebad1, d2ebae1, d2ebaf1, d2ebag1, d2ebah1, d2ebai1 automated match to d1siqa1 complexed with fad |
PDB Entry: 2eba (more details), 2.21 Å
SCOPe Domain Sequences for d2ebah2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebah2 a.29.3.0 (H:234-385) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} lkaplscltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlaw hteglllawrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhair hmlnletvytyegthdvhtlvlgreitglnaf
Timeline for d2ebah2: