Lineage for d2ebaf2 (2eba F:234-385)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731940Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1732074Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1732075Protein automated matches [226935] (21 species)
    not a true protein
  7. 1732218Species Thermus thermophilus HB8 [TaxId:300852] [225241] (1 PDB entry)
  8. 1732223Domain d2ebaf2: 2eba F:234-385 [204101]
    Other proteins in same PDB: d2ebaa1, d2ebac1, d2ebad1, d2ebae1, d2ebaf1, d2ebag1, d2ebah1, d2ebai1
    automated match to d1siqa1
    complexed with fad

Details for d2ebaf2

PDB Entry: 2eba (more details), 2.21 Å

PDB Description: Crystal structure of the putative glutaryl-CoA dehydrogenase from thermus thermophilus
PDB Compounds: (F:) Putative glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d2ebaf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebaf2 a.29.3.0 (F:234-385) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
lkaplscltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlaw
hteglllawrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhair
hmlnletvytyegthdvhtlvlgreitglnaf

SCOPe Domain Coordinates for d2ebaf2:

Click to download the PDB-style file with coordinates for d2ebaf2.
(The format of our PDB-style files is described here.)

Timeline for d2ebaf2: