SCOPe 2.03: Domain d2ebae1: 2eba E:1-233

Lineage for d2ebae1 (2eba E:1-233)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (14 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [225240] (1 PDB entry)

8. Domain d2ebae1: 2eba E:1-233 [204098]
   Other proteins in same PDB: d2ebaa2, d2ebac2, d2ebad2, d2ebae2, d2ebaf2, d2ebag2, d2ebah2, d2ebai2
   automated match to d1siqa2
   complexed with fad

Details for d2ebae1

PDB Entry: 2eba, 2.21 Å

PDB Description: Crystal structure of the putative glutaryl-CoA dehydrogenase from thermus thermophilus

PDB Compounds: (E:) Putative glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d2ebae1:

Sequence, based on SEQRES records:

>d2ebae1 e.6.1.0 (E:1-233) automated matches {Thermus thermophilus [TaxId: 300852]}
mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
argemvgcfgltepdggsdpygnmktrarregdtwvlngtkmwitngnlahlaviwakde
ggevlgflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalg

Sequence, based on observed residues (ATOM records):

>d2ebae1 e.6.1.0 (E:1-233) automated matches {Thermus thermophilus [TaxId: 300852]}
mldfyaledlltpeekevqkaarrflekealphirdwweegvfpthliprfaelgflgpt
lppeyggagvssaayglicyelervdsglrsfvsvqsslvmypiyaygseeqkreflpkl
argemvgcfgltepdggsdpygnmktrarrdtwvlngtkmwitngnlahlaviwakdevl
gflvptdtpgfqarevkrkmslrasvtselvleevrvpeslrlpkalg

Timeline for d2ebae1:

• d2ebae1 is new in SCOPe 2.03-stable
  
• d2ebae1 appears in SCOPe 2.04
  
• d2ebae1 appears in the current release, SCOPe 2.08