SCOPe 2.08: Domain d2ebaa2: 2eba A:234-385

Lineage for d2ebaa2 (2eba A:234-385)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225241] (1 PDB entry)

8. Domain d2ebaa2: 2eba A:234-385 [204093]
   Other proteins in same PDB: d2ebaa1, d2ebac1, d2ebad1, d2ebae1, d2ebaf1, d2ebag1, d2ebah1, d2ebai1
   automated match to d1siqa1
   complexed with fad

Details for d2ebaa2

PDB Entry: 2eba, 2.21 Å

PDB Description: Crystal structure of the putative glutaryl-CoA dehydrogenase from thermus thermophilus

PDB Compounds: (A:) Putative glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d2ebaa2:

Sequence; same for both SEQRES and ATOM records:

>d2ebaa2 a.29.3.0 (A:234-385) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
lkaplscltqarfgiawgamgaleavyeeavafaksrstfgeplakkqlvqaklaemlaw
hteglllawrlarlkdegkltpaqvslakrqnvwkalqaarmardilggsgitleyhair
hmlnletvytyegthdvhtlvlgreitglnaf

Timeline for d2ebaa2:

• d2ebaa2 first appeared in SCOPe 2.03
  
• d2ebaa2 appears in SCOPe 2.07