SCOPe 2.05: Domain d2eaua4: 2eau A:361-599

Lineage for d2eaua4 (2eau A:361-599)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
   unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432

4. Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family)

5. Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)

6. Protein Calcium ATPase [81658] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (40 PDB entries)
   Uniprot P04191

8. Domain d2eaua4: 2eau A:361-599 [204091]
   Other proteins in same PDB: d2eaua1, d2eaua2, d2eaua3
   automated match to d1wpga3
   complexed with cza, pty

Details for d2eaua4

PDB Entry: 2eau, 2.8 Å

PDB Description: crystal structure of the sr ca2+-atpase with bound cpa in the presence of curcumin

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d2eaua4:

Sequence; same for both SEQRES and ATOM records:

>d2eaua4 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

Timeline for d2eaua4:

• d2eaua4 first appeared in SCOPe 2.03
  
• d2eaua4 appears in SCOPe 2.04
  
• d2eaua4 appears in SCOPe 2.06
  
• d2eaua4 appears in the current release, SCOPe 2.08