SCOPe 2.06: Domain d1ct8b1: 1ct8 B:1-113

Lineage for d1ct8b1 (1ct8 B:1-113)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 3.3 [TaxId:10090] [88553] (1 PDB entry)
Domain d1ct8b1: 1ct8 B:1-113 [20409]
Other proteins in same PDB: d1ct8a1, d1ct8a2, d1ct8b2, d1ct8c1, d1ct8c2, d1ct8d2
part of catalytic Fab 7C8
complexed with so4, taa

Details for d1ct8b1

PDB Entry: 1ct8 (more details), 2.2 Å

PDB Description: catalytic antibody 7c8 complex

PDB Compounds: (B:) 7c8 fab fragment; long chain

SCOPe Domain Sequences for d1ct8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]}
qvkllesgavlvkpgasvklscktsgftfsssyinwlkqkpgqslewiawiyagsggtvy
nqhftdkarltvdtssstaymqfsslttedsaiyycaryrydegfaywgqgtlvtvsa

SCOPe Domain Coordinates for d1ct8b1:

Click to download the PDB-style file with coordinates for d1ct8b1.
(The format of our PDB-style files is described here.)

Timeline for d1ct8b1: