| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Catalytic Fab 7C8, (mouse), kappa L chain [48885] (1 PDB entry) |
| Domain d1ct8b1: 1ct8 B:1-113 [20409] Other proteins in same PDB: d1ct8a2, d1ct8b2, d1ct8c2, d1ct8d2 |
PDB Entry: 1ct8 (more details), 2.2 Å
SCOP Domain Sequences for d1ct8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 7C8, (mouse), kappa L chain}
qvkllesgavlvkpgasvklscktsgftfsssyinwlkqkpgqslewiawiyagsggtvy
nqhftdkarltvdtssstaymqfsslttedsaiyycaryrydegfaywgqgtlvtvsa
Timeline for d1ct8b1: