Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) a distorted variant of double-helix |
Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins) |
Protein Calcium ATPase, transduction domain A [81651] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (42 PDB entries) Uniprot P04191 |
Domain d2eata2: 2eat A:125-239 [204085] Other proteins in same PDB: d2eata1, d2eata3, d2eata4 automated match to d1wpga1 complexed with cza, tg1 |
PDB Entry: 2eat (more details), 2.9 Å
SCOPe Domain Sequences for d2eata2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eata2 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d2eata2: