Lineage for d2e5fa_ (2e5f A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140444Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2140445Protein automated matches [190547] (14 species)
    not a true protein
  7. 2140508Species Pyrococcus horikoshii OT3 [TaxId:70601] [193200] (3 PDB entries)
  8. 2140509Domain d2e5fa_: 2e5f A: [204080]
    automated match to d2decb_
    complexed with edo, po4

Details for d2e5fa_

PDB Entry: 2e5f (more details), 1.35 Å

PDB Description: Crystal Structure of the PH0510 protein from Pyrococcus horikoshii OT3 in complex with phosphate ion
PDB Compounds: (A:) Hypothetical protein PH0510

SCOPe Domain Sequences for d2e5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5fa_ c.80.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mktlieikqtpdgiikadkvfnkvkdkislpnrilylgcgsshflskllamvtnmhgglg
ialpcseflysketypigevelavgisrsgetteillalekinvkklgittressltrmc
dyslvvpaieesvvmthsftsfyfaylqllrysyglpplnageiskateksleyeryire
ivesfdfqniiflgsgllypvaleaslkmkemsifwseayptfevrhgfkaiadektlvv
lmveepfewheklvkefknqgakvlvisnspqdlgqdysielprlskdanpipylpivql
lsyykavsrglnpdnprfldkvvrw

SCOPe Domain Coordinates for d2e5fa_:

Click to download the PDB-style file with coordinates for d2e5fa_.
(The format of our PDB-style files is described here.)

Timeline for d2e5fa_: