Lineage for d2e40a_ (2e40 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083775Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [225236] (2 PDB entries)
  8. 2083778Domain d2e40a_: 2e40 A: [204078]
    automated match to d3ahxa_
    complexed with lgc

Details for d2e40a_

PDB Entry: 2e40 (more details), 1.9 Å

PDB Description: Crystal structure of intracellular family 1 beta-glucosidase BGL1A from the basidiomycete Phanerochaete chrysosporium in complex with gluconolactone
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2e40a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e40a_ c.1.8.0 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
aklpksfvwgyataayqiegspdkdgrepsiwdtfckapgkiadgssgdvatdsynrwre
dvqllksygvkayrfslswsriipkggrsdpvngagikhyrtlieelvkegitpfvtlyh
wdlpqalddryggwlnkeeaiqdftnyaklcfesfgdlvqnwitfnepwvisvmgygngi
fapghvsntepwivshhiilahahavklyrdefkekqggqigitldshwlipyddtdask
eatlramefklgrfanpiykgeypprikkilgdrlpeftpeeielvkgssdffglntytt
hlvqdggsdelagfvktghtradgtqlgtqsdmgwlqtygpgfrwllnylwkaydkpvyv
tengfpvkgendlpveqavddtdrqayyrdyteallqavtedgadvrgyfgwslldnfew
aegykvrfgvthvdyetqkrtpkksaeflsrwfkehiee

SCOPe Domain Coordinates for d2e40a_:

Click to download the PDB-style file with coordinates for d2e40a_.
(The format of our PDB-style files is described here.)

Timeline for d2e40a_: