Lineage for d2e3za_ (2e3z A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083775Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [225236] (2 PDB entries)
  8. 2083776Domain d2e3za_: 2e3z A: [204076]
    automated match to d3ahxa_

Details for d2e3za_

PDB Entry: 2e3z (more details), 1.5 Å

PDB Description: Crystal structure of intracellular family 1 beta-glucosidase BGL1A from the basidiomycete Phanerochaete chrysosporium in substrate-free form
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2e3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e3za_ c.1.8.0 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
aaklpksfvwgyataayqiegspdkdgrepsiwdtfckapgkiadgssgdvatdsynrwr
edvqllksygvkayrfslswsriipkggrsdpvngagikhyrtlieelvkegitpfvtly
hwdlpqalddryggwlnkeeaiqdftnyaklcfesfgdlvqnwitfnepwvisvmgygng
ifapghvsntepwivshhiilahahavklyrdefkekqggqigitldshwlipyddtdas
keatlramefklgrfanpiykgeypprikkilgdrlpeftpeeielvkgssdffglntyt
thlvqdggsdelagfvktghtradgtqlgtqsdmgwlqtygpgfrwllnylwkaydkpvy
vtengfpvkgendlpveqavddtdrqayyrdyteallqavtedgadvrgyfgwslldnfe
waegykvrfgvthvdyetqkrtpkksaeflsrwfkehiee

SCOPe Domain Coordinates for d2e3za_:

Click to download the PDB-style file with coordinates for d2e3za_.
(The format of our PDB-style files is described here.)

Timeline for d2e3za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2e3zb_