SCOPe 2.04: Domain d2e3ua1: 2e3u A:33-115

Lineage for d2e3ua1 (2e3u A:33-115)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.0: automated matches [227159] (1 protein)
   not a true family

6. Protein automated matches [226866] (4 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [225353] (1 PDB entry)

8. Domain d2e3ua1: 2e3u A:33-115 [204074]
   automated match to d1tuaa1

Details for d2e3ua1

PDB Entry: 2e3u, 2.3 Å

PDB Description: Crystal structure analysis of Dim2p from Pyrococcus horikoshii OT3

PDB Compounds: (A:) Hypothetical protein PH1566

SCOPe Domain Sequences for d2e3ua1:

Sequence; same for both SEQRES and ATOM records:

>d2e3ua1 d.51.1.0 (A:33-115) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
kqeeyvkipkdriavligkkgqtkkeiekrtktkitidsetgevwitstketedplavwk
ardivlaigrgfsperafrllne

Timeline for d2e3ua1:

• d2e3ua1 first appeared in SCOPe 2.03
  
• d2e3ua1 appears in SCOPe 2.05
  
• d2e3ua1 appears in the current release, SCOPe 2.08