Lineage for d2e3ua1 (2e3u A:33-115)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648551Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1648552Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1648659Family d.51.1.0: automated matches [227159] (1 protein)
    not a true family
  6. 1648660Protein automated matches [226866] (4 species)
    not a true protein
  7. 1648678Species Pyrococcus horikoshii [TaxId:70601] [225353] (1 PDB entry)
  8. 1648679Domain d2e3ua1: 2e3u A:33-115 [204074]
    automated match to d1tuaa1

Details for d2e3ua1

PDB Entry: 2e3u (more details), 2.3 Å

PDB Description: Crystal structure analysis of Dim2p from Pyrococcus horikoshii OT3
PDB Compounds: (A:) Hypothetical protein PH1566

SCOPe Domain Sequences for d2e3ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e3ua1 d.51.1.0 (A:33-115) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
kqeeyvkipkdriavligkkgqtkkeiekrtktkitidsetgevwitstketedplavwk
ardivlaigrgfsperafrllne

SCOPe Domain Coordinates for d2e3ua1:

Click to download the PDB-style file with coordinates for d2e3ua1.
(The format of our PDB-style files is described here.)

Timeline for d2e3ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e3ua2