SCOPe 2.08: Domain d2e37g2: 2e37 G:142-310

Lineage for d2e37g2 (2e37 G:142-310)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries)

8. Domain d2e37g2: 2e37 G:142-310 [204071]
   Other proteins in same PDB: d2e37a1, d2e37b1, d2e37c1, d2e37d1, d2e37e1, d2e37f1, d2e37g1, d2e37h1
   automated match to d1llda2
   complexed with nad, so4

Details for d2e37g2

PDB Entry: 2e37, 2.3 Å

PDB Description: Structure of TT0471 protein from Thermus thermophilus

PDB Compounds: (G:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2e37g2:

Sequence; same for both SEQRES and ATOM records:

>d2e37g2 d.162.1.0 (G:142-310) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

Timeline for d2e37g2:

• d2e37g2 first appeared in SCOPe 2.03
  
• d2e37g2 appears in SCOPe 2.07