Lineage for d1r24d1 (1r24 D:1-122)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287316Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (47 PDB entries)
  8. 287372Domain d1r24d1: 1r24 D:1-122 [20407]
    Other proteins in same PDB: d1r24a1, d1r24a2, d1r24b2, d1r24c1, d1r24c2, d1r24d2
    part of humanized Fab R24 from murine ascites

Details for d1r24d1

PDB Entry: 1r24 (more details), 3.1 Å

PDB Description: fab from murine igg3 kappa

SCOP Domain Sequences for d1r24d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r24d1 b.1.1.1 (D:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
ss

SCOP Domain Coordinates for d1r24d1:

Click to download the PDB-style file with coordinates for d1r24d1.
(The format of our PDB-style files is described here.)

Timeline for d1r24d1: