![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab R24, (mouse), kappa L chain [48884] (2 PDB entries) |
![]() | Domain d1r24d1: 1r24 D:1-122 [20407] Other proteins in same PDB: d1r24a2, d1r24b2, d1r24c2, d1r24d2 |
PDB Entry: 1r24 (more details), 3.1 Å
SCOP Domain Sequences for d1r24d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r24d1 b.1.1.1 (D:1-122) Immunoglobulin (variable domains of L and H chains) {Fab R24, (mouse), kappa L chain} dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv ss
Timeline for d1r24d1: